PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0515s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 324aa    MW: 34818.4 Da    PI: 6.605
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0515s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.54.7e-363083255
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggr 55
                            +e+a+kcprC+s ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg 
  SapurV1A.0515s0120.1.p 30 QEQASKCPRCESPNTKFCYYNNYSLAQPRHFCKTCRRYWTKGGALRNVPIGGGY 83
                            57899***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-232982IPR003851Zinc finger, Dof-type
PfamPF027011.2E-303283IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.7293488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVPPVDLQET SKDDNQSSTS NRKTATTRPQ EQASKCPRCE SPNTKFCYYN NYSLAQPRHF  60
CKTCRRYWTK GGALRNVPIG GGYSTGSLEI SGFNFFHGLS PTVDFNLGGL SLPRLNPSQN  120
GLYSHFPSFG DTSAAAVTVT SPCFSLDPSV SSTAGSCSLM GLNYPLTSVT NRFCNAIQEN  180
IGGGSMNVNT NLPSSIESLS CINQDLHWKL QQQRLAMLYG TGENHKDGST VSTDPIDQSL  240
GHKPQPIMFE NLEISKPQVC AAGNPGKEGA ASGDTATEWF FGNSYSQVTA TPTNASNNGN  300
NDNTGNWNGV QAWGDLHQYS VLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4668682e-38AM466868.2 Vitis vinifera contig VV78X015400.11, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006380583.11e-180hypothetical protein POPTR_0007s09520g
TrEMBLU5G4P21e-180U5G4P2_POPTR; Uncharacterized protein
STRINGPOPTR_0005s19310.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-54Dof family protein